Recombinant Human ERK1 Protein (RMPP-00230063)
Cat. No.: RMPP-00230063
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
5 μg
10 μg
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 95% SDS-PAGE. Protein A purified. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | Fc tag C-Terminus |
| Form | Lyophilized |
| Applications | ELISA; SDS-PAGE |
| Key Features | Expression system: HEK 293 cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/ μg; Active: Yes; Tags: Fc tag C-Terminus; Suitable for: ELISA, SDS-PAGE |
Protein Information
| Molecular Weight | 36 kDa including tags |
|---|---|
| Molecular Weight Information | The protein migrates as 40-43 kDa under reducing condition. |
| Sequence | DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDF SEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD |
| Protein Length | Protein fragment |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.4Constituents: 0.61% Tris, 5% Trehalose, Glycine, Sodium chloride, L-Arginine This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
