Recombinant Human Flt3 ligand/Flt3L Protein (Active) (RMPP-00230134)
Cat. No.: RMPP-00230134
Category: Recombinant Protein
Research Area: Epigenetics and Nuclear Signaling
INQUIRY
100 μg
250 µg
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Tags | GST tag N-Terminus |
| Form | Liquid |
| Applications | ELISA; WB |
| Key Features | Expression system: Wheat germ; Tags: GST tag N-Terminus; Suitable for: ELISA, WB |
Protein Information
| UniProt ID | Q8TDD2 |
|---|---|
| Sequence | GYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYG SWYKAGIHAGISPGPGNTPTPWWDMH |
| Sequence Similarities | Belongs to the Sp1 C2H2-type zinc-finger protein family. Contains 3 C2H2-type zinc fingers. |
| Protein Length | Protein fragment |
| Cellular Localization | Nucleus. |
| Tissue Specificity | Restricted to bone-derived cell. |
| Function | Transcriptional activator essential for osteoblast differentiation. Binds to SP1 and EKLF consensus sequences and to other G/C-rich sequences. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
