Recombinant Human BMPR1A Protein (RMPP-00230486)
Cat. No.: RMPP-00230486
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
5 μg
10 μg
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | ≥ 95% HPLC. SDS-PAGE ≥ 95% |
| Nature | Recombinant |
| Endotoxin Level | ≤ 0.005 Eu/µg |
| Animal Free | Yes |
| Form | Lyophilized |
| Applications | HPLC; MS; SDS-PAGE |
| Key Features | Expression system: HEK 293 cells; Purity: ≥ 95% HPLC; Endotoxin level: ≤ 0.005 Eu/ μg; Suitable for: HPLC, MS, SDS-PAGE |
Protein Information
| UniProt ID | P40238 |
|---|---|
| Molecular Weight | 37 kDa |
| Molecular Weight Information | 37124.96808 +/- 10Da |
| Sequence | QVSSQDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPSGTYQLLYAYPR EKPRACPLSSQSMPHFGTRYVCQFPDQEEVRLFFPLHLWVKNVFLNQTRT QRVLFVDSVGLPAPPSIIKAMGGSQPGELQISWEEPAPEISDFLRYELRY GPRDPKNSTGPTVIQLIATETCCPALQRPHSASALDQSPCAQPTMPWQDG PKQTSPSREASALTAEGGSCLISGLQPGNSYWLQLRSEPDGISLGGSWGS WSLPVTVDLPGDAVALGLQCFTLDLKNVTCQWQQQDHASSQGFFYHSRAR CCPRDRYPIWENCEEEEKTNPGLQTPQFSRCH |
| Sequence Similarities | Belongs to the type I cytokine receptor family. Type 1 subfamily. Contains 2 fibronectin type-III domains. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Tissue Specificity | Expressed at a low level in a large number of cells of hematopoietic origin. Isoform 1 and isoform 2 are always found to be coexpressed. |
| Domain | The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.The box 1 motif is required for JAK interaction and/or activation. |
| Function | Receptor for thrombopoietin. May represent a regulatory molecule specific for TPO-R-dependent immune responses. |
| Involvement in Disease | Defects in MPL are a cause of congenital amegakaryocytic thrombocytopenia (CAMT). CAMT is a disease characterized by isolated thrombocytopenia and megakaryocytopenia with no physical anomalies. |
Storage & Shipping
| Shipping and Storage | Shipped at Room Temperature. Store at Room Temperature. pH: 7.40Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% Trehalose |
|---|
For research use only. Not for clinical use.
