Recombinant Human IL-4 Protein (RMPP-00230387)
Cat. No.: RMPP-00230387
Category: Recombinant Protein
Research Area: Tags & Cell Markers
INQUIRY
5 μg
Customer Size
Product Features
| Source | Baculovirus infected insect cells |
|---|---|
| Purity | > 95% SDS-PAGE. Affinity purified |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | His tag C-Terminus |
| Form | Liquid |
| Applications | Functional Studies; SDS-PAGE |
| Key Features | Expression system: Baculovirus infected insect cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: His tag C-Terminus; Suitable for: Functional Studies, SDS-PAGE |
Protein Information
| UniProt ID | P01034 |
|---|---|
| Molecular Weight | 14 kDa including tags |
| Sequence | GTSRPPPRLLGAPQEADASEEGVQRALDFAVSEYNKGSNDAYHSRAIQVV RARKQLVAGINYYLDVEMGRTTCTKSQTNLTNCPFHDQPHLMRKALCSFQ IYSVPWKGTHTLTKSSCKNALEHHHHHH |
| Sequence Similarities | Belongs to the cystatin family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Tissue Specificity | Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in various body fluids, such as the cerebrospinal fluid and plasma. Expressed in highest levels in the epididymis, vas deferens, brain, thymus, and ovary and the lowest in the submandibular gland. |
| Function | As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity. |
| Involvement in Disease | Amyloidosis 6Macular degeneration, age-related, 11 |
| Post-translational Modifications | The Thr-25 variant is O-glycosylated with a core 1 or possibly core 8 glycan. The signal peptide of the O-glycosylated Thr-25 variant is cleaved between Ala-20 and Val-21. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.40Constituents: 10% Glycerol (glycerin, glycerine), 90% PBS This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
