Banner

Recombinant Human IL-4 Protein (RMPP-00230387)

Cat. No.: RMPP-00230387

Category: Recombinant Protein

Research Area: Tags & Cell Markers

INQUIRY 5 μg Customer Size

Product Features

Source Baculovirus infected insect cells
Purity > 95% SDS-PAGE. Affinity purified
Nature Recombinant
Endotoxin Level < 1.000 Eu/µg
Animal Free No
Tags His tag C-Terminus
Form Liquid
Applications Functional Studies; SDS-PAGE
Key Features Expression system: Baculovirus infected insect cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: His tag C-Terminus; Suitable for: Functional Studies, SDS-PAGE

Protein Information

UniProt ID P01034
Molecular Weight 14 kDa including tags
Sequence GTSRPPPRLLGAPQEADASEEGVQRALDFAVSEYNKGSNDAYHSRAIQVV RARKQLVAGINYYLDVEMGRTTCTKSQTNLTNCPFHDQPHLMRKALCSFQ IYSVPWKGTHTLTKSSCKNALEHHHHHH
Sequence Similarities Belongs to the cystatin family.
Protein Length Full length protein
Cellular Localization Secreted.
Tissue Specificity Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in various body fluids, such as the cerebrospinal fluid and plasma. Expressed in highest levels in the epididymis, vas deferens, brain, thymus, and ovary and the lowest in the submandibular gland.
Function As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity.
Involvement in Disease Amyloidosis 6Macular degeneration, age-related, 11
Post-translational Modifications The Thr-25 variant is O-glycosylated with a core 1 or possibly core 8 glycan. The signal peptide of the O-glycosylated Thr-25 variant is cleaved between Ala-20 and Val-21.

Storage & Shipping

Shipping and Storage Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40Constituents: 10% Glycerol (glycerin, glycerine), 90% PBS
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.