Recombinant Human LipoProtein lipase (RMPP-00230560)
Cat. No.: RMPP-00230560
Category: Kinases
Research Area: Signal Transduction
INQUIRY
100 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | His tag C-Terminus |
| Form | Lyophilized |
| Applications | SDS-PAGE |
| Key Features | Expression system: HEK 293 cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Tags: His tag C-Terminus; Suitable for: SDS-PAGE |
Protein Information
| UniProt ID | Q01974 |
|---|---|
| Molecular Weight | 43 kDa including tags |
| Sequence | EVEVLDPNDPLGPLDGQDGPIPTLKGYFLNFLEPVNNITIVQGQTAILHC KVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYY QCVATNGMKTITATGVLFVRLGPTHSPNHNFQDDYHEDGFCQPYRGIACA RFIGNRTIYVDSLQMQGEIENRITAAFTMIGTSTHLSDQCSQFAIPSFCH FVFPLCDARSRTPKPRELCRDECEVLESDLCRQEYTIARSNPLILMRLQL PKCEALPMPESPDAANCMRIGIPAERLGRYHQCYNGSGMDYRGTASTTKS GHQCQPWALQHPHSHHLSSTDFPELGGGHAYCRNPGGQMEGPWCFTQNKN VRMELCDVPSCSPRDSSKMG |
| Sequence Similarities | Belongs to the protein kinase superfamily. Tyr protein kinase family. ROR subfamily. Contains 1 FZ (frizzled) domain. Contains 1 Ig-like C2-type (immunoglobulin-like) domain. Contains 1 kringle domain. Contains 1 protein kinase domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Cell membrane. |
| Developmental Stage | Expressed at high levels during early embryonic development. The expression levels drop strongly around day 16 and there are only very low levels in adult tissues. |
| Function | Tyrosine-protein kinase receptor which may be involved in the early formation of the chondrocytes. It seems to be required for cartilage and growth plate development. Phosphorylates YWHAB, leading to induction of osteogenesis and bone formation. |
| Involvement in Disease | Brachydactyly B1Robinow syndrome autosomal recessive |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. pH: 7.40Constituents: 95% PBS, 5% TrehaloseLyophilized from 0.22 µm filtered solution. |
|---|
For research use only. Not for clinical use.
