Recombinant Human IL-1R-2 Protein (Fc Chimera Active) (RMPP-00230578)
Cat. No.: RMPP-00230578
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
100 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Form | Lyophilized |
| Applications | SDS-PAGE |
| Key Features | Expression system: HEK 293 cells; Purity: > 95% SDS-PAGE; Suitable for: SDS-PAGE |
Protein Information
| UniProt ID | P38484 |
|---|---|
| Sequence | Theoretical sequence: SQLPAPQHPKIRLYNAEQVLSWEPVALSNSTRPVVYRVQFKYTDSKWF TADIMSIGVNCTQITATECDFTAASPSAGFPMDFNVTLRLRAELGALH SAWVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTA FFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWN KSNIFRVGHLSNISCYETMADASTELQQGSSNTKVDKKVEPKSCDKTH TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE VKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Sequence Similarities | Belongs to the type II cytokine receptor family. Contains 2 fibronectin type-III domains. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Function | Part of the receptor for interferon gamma. Required for signal transduction. This accessory factor is an integral part of the IFN-gamma signal transduction pathway and is likely to interact with GAF, JAK1, and/or JAK2. |
| Involvement in Disease | Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD); also known as familial disseminated atypical mycobacterial infection. This rare condition confers predisposition to illness caused by moderately virulent mycobacterial species, such as Bacillus Calmette-Guerin (BCG) vaccine and environmental non-tuberculous mycobacteria, and by the more virulent Mycobacterium tuberculosis. Other microorganisms rarely cause severe clinical disease in individuals with susceptibility to mycobacterial infections, with the exception of Salmonella which infects less than 50% of these individuals. The pathogenic mechanism underlying MSMD is the impairment of interferon-gamma mediated immunity, whose severity determines the clinical outcome. Some patients die of overwhelming mycobacterial disease with lepromatous-like lesions in early childhood, whereas others develop, later in life, disseminated but curable infections with tuberculoid granulomas. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C. Constituents: 1% Human serum albumin, 10% Trehalose |
|---|
For research use only. Not for clinical use.
