Banner

Recombinant Human SDF1 Protein (Active)

Recombinant Human SDF1 Protein (Active) (RMPP-00230826)

Cat. No.: RMPP-00230826

Category: Recombinant Protein

Research Area: Stem Cells

INQUIRY 10 μg Customer Size

Product Features

Source HEK 293 cells
Purity ≥ 95% HPLC. SDS-PAGE ≥ 95%
Nature Recombinant
Endotoxin Level ≤ 0.005 Eu/µg
Carrier Free Yes
Animal Free Yes
Form Lyophilized
Applications SDS-PAGE; HPLC; MS
Key Features Expression system: HEK 293 cells; Purity: ≥ 95% HPLC; Endotoxin level: ≤ 0.005 Eu/µg; Suitable for: SDS-PAGE, HPLC, MS

Protein Information

UniProt ID P51654
Molecular Weight 60 kDa
Molecular Weight Information Predicted MW is 60317.25 Da (+/-10 Da by ESI-TOF). Observed MW is 60321.20 Da.
Sequence QPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGSDLQVCLPKGPTCCS RKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVRHAKN YTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSL FPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVSKSLQ VTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPC GGYCNVVMQGCMAGVVEIDKYWREYILSLEELVNGMYRIYDMENVLLGLF STIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVLK VAHVEHEETLSSRRRELIQKLKSFISFYSALPGYICSHSPVAENDTLCWN GQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLR TMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLA ELAYDLDVDDAPGNSQQATPKDNEISTFHN
Sequence Similarities Belongs to the glypican family.
Protein Length Full length protein
Cellular Localization Cell membrane and Secreted > extracellular space.
Tissue Specificity Highly expressed in lung, liver and kidney.
Function Cell surface proteoglycan that bears heparan sulfate. Inhibits the dipeptidyl peptidase activity of DPP4. May be involved in the suppression/modulation of growth in the predominantly mesodermal tissues and organs. May play a role in the modulation of IGF2 interactions with its receptor and thereby modulate its function. May regulate growth and tumor predisposition.
Involvement in Disease Defects in GPC3 are the cause of Simpson-Golabi-Behmel syndrome type 1 (SGBS1); also known as Simpson dysmorphia syndrome (SDYS). SGBS is a condition characterized by pre- and postnatal overgrowth (gigantism) with visceral and skeletal anomalies.

Storage & Shipping

Shipping and Storage Shipped at Room Temperature. Store at Room Temperature.
pH: 7.4Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% Trehalose

For research use only. Not for clinical use.