Recombinant Human SMAD5 Protein (RMPP-00230729)
Cat. No.: RMPP-00230729
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
50 μg
20 μg
Product Features
| Source | Baculovirus infected insect cells |
|---|---|
| Purity | > 95% SDS-PAGE. Affinity purified |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | His tag C-Terminus |
| Form | Liquid |
| Applications | SDS-PAGE; Functional Studies |
| Key Features | Expression system: Baculovirus infected insect cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: His tag C-Terminus; Suitable for: SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | P19235 |
|---|---|
| Molecular Weight | 26 kDa including tags |
| Sequence | APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGP GNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRV TAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPM TSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARM AEPSFGGFWSAWSEPVSLLTPSDLDPHHHHHH |
| Sequence Similarities | Belongs to the type I cytokine receptor family. Type 1 subfamily. Contains 1 fibronectin type-III domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Cell membrane and Secreted. Secreted and located to the cell surface. |
| Tissue Specificity | Erythroid cells and erythroid progenitor cells. Isoform EPOR-F is the mostthis product form in EPO-dependent erythroleukemia cells and in late-stage erythroid progenitors. Isoform EPOR-S and isoform EPOR-T are the predominant forms in bone marrow. Isoform EPOR-T is the mostthis product from in early-stage erythroid progenitor cells. |
| Domain | The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.The box 1 motif is required for JAK interaction and/or activation.Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases. |
| Function | Receptor for erythropoietin. Mediates erythropoietin-induced erythroblast proliferation and differentiation. Upon EPO stimulation, EPOR dimerizes triggering the JAK2/STAT5 signaling cascade. In some cell types, can also activate STAT1 and STAT3. May also activate the LYN tyrosine kinase.Isoform EPOR-T acts as a dominant-negative receptor of EPOR-mediated signaling. |
| Involvement in Disease | Defects in EPOR are the cause of erythrocytosis familial type 1 (ECYT1). ECYT1 is an autosomal dominant disorder characterized by increased serum red blood cell mass, elevated hemoglobin and hematocrit, hypersensitivity of erythroid progenitors to erythropoietin, erythropoietin low serum levels, and no increase in platelets nor leukocytes. It has a relatively benign course and does not progress to leukemia. |
| Post-translational Modifications | On EPO stimulation, phosphorylated on C-terminal tyrosine residues by JAK2. The phosphotyrosine motifs are also recruitment sites for several SH2-containing proteins and adapter proteins which mediate cell proliferation. Phosphorylation on Tyr-454 is required for PTPN6 interaction, Tyr-426 for PTPN11. Tyr-426 is also required for SOCS3 binding, but Tyr-454/Tyr-456 motif is the preferred binding site.Ubiquitinated by NOSIP; appears to be either multi-monoubiquitinated or polyubiquitinated. Ubiquitination mediates proliferation and survival of EPO-dependent cells. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.40Constituents: 10% Glycerol (glycerin, glycerine), 90% PBS This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.