Recombinant Human Syndecan-1 Protein (His tag) (RMPP-00230920)
Cat. No.: RMPP-00230920
Category: Recombinant Protein
Research Area: Signal Transduction
INQUIRY
100 μg
Customer Size
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | SDS-PAGE; WB; ELISA |
| Key Features | Expression system: Wheat germ; Suitable for: SDS-PAGE, WB, ELISA |
Protein Information
| UniProt ID | P11168 |
|---|---|
| Molecular Weight | 66 kDa including tags |
| Sequence | MYIGEIAPTALRGALGTFHQLAIVTGILISQIIGLEFILGNYDLWHILLG LSGVRAILQSLLLFFCPESPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDI NEMRKEREEASSEQKVSIIQLFTNSSYRQPILVALMLHVAQQFSGINGIF YYSTSIFQTAGISKPVYATIGVGAVNMVFTAVSVFLVEKAGRRSLFLIGM SGMFVCAIFMSVGLVLLNKFSWMSYVSMIAIFLFVSFFEIGPGPIPWFMV AEFFSQGPRPAALAIAAFSNWTCNFIVALCFQYIADFCGPYVFFLFAGVL LAFTLFTFFKVPETKGKSFEEIAAEFQKKSGSAHRPKAAVEMKFLGATET V |
| Sequence Similarities | Belongs to the major facilitator superfamily. Sugar transporter (TC 2. A. 1. 1) family. Glucose transporter subfamily. |
| Protein Length | Full length protein |
| Cellular Localization | Membrane. |
| Tissue Specificity | Liver, insulin-producing beta cell, small intestine and kidney. |
| Function | Facilitative glucose transporter. This isoform likely mediates the bidirectional transfer of glucose across the plasma membrane of hepatocytes and is responsible for uptake of glucose by the beta cells; may comprise part of the glucose-sensing mechanism of the beta cell. May also participate with the Na(+)/glucose cotransporter in the transcellular transport of glucose in the small intestine and kidney. |
| Involvement in Disease | Fanconi-Bickel syndrome |
| Post-translational Modifications | N-glycosylated; required for stability and retention at the cell surface of pancreatic beta cells. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
