Banner

Recombinant Human Vimentin Protein (Tagged-His Tag)

Recombinant Human Vimentin Protein (Tagged-His Tag) (RMPP-00230689)

Cat. No.: RMPP-00230689

Category: Recombinant Protein

Research Area: Cardiovascular

INQUIRY 50 μg 20 μg

Product Features

Source E.coli
Purity > 95% SDS-PAGE. Purity determined by Reducing and Non-reducing SDS-PAGE.
Nature Recombinant
Endotoxin Level ≤ 1.000 Eu/µg
Animal Free Yes
Form Lyophilized
Applications SDS-PAGE; Functional Studies
Key Features Expression system: E.coli; Purity: > 95% SDS-PAGE; Endotoxin level: ≤ 1.000 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, Functional Studies

Protein Information

Molecular Weight 26 kDa
Sequence Alpha chain:
MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVK RCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLEC ACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT


Beta chain:
SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPP CVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIGIVRKKPIFKKATVTLG DHLACKCETVAAARPVT
Protein Length Full length protein
Cellular Localization Secreted
Relevance Platelet Derived Growth Factor (PDGF) is a potent mitogen for a wide range of cell types including fibroblasts, smooth muscle and connective tissue. PDGF, which is composed of a dimer of two chains joined by disulphide bonds, termed the A chain and B chain, can be present as AA or BB homodimers or as an AB heterodimer. Human PDGF-AB is a 25.5 kDa heterodimer protein consisting of a 13.3 kDa A chain and a 12.2 kDa B chain.

Storage & Shipping

Shipping and Storage Shipped at 4°C. Upon delivery aliquot. Store at -20°C. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).
Constituent: 0.06% Acetic acid
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.