Recombinant Mouse HDAC5 Protein (Active) (RMPP-00230665)
Cat. No.: RMPP-00230665
Category: Recombinant Protein
Research Area: Epigenetics and Nuclear Signaling
INQUIRY
5 μg
Customer Size
Product Features
| Source | Baculovirus infected Sf9 cells |
|---|---|
| Purity | ≥ 5% SDS-PAGE. Affinity purified. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | GST tag N-Terminus |
| Form | Liquid |
| Applications | SDS-PAGE; Functional Studies |
| Key Features | Expression system: Baculovirus infected Sf9 cells; Purity: ≥ 50% SDS-PAGE; Active: Yes; Tags: GST tag N-Terminus; Suitable for: SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | Q96KQ7 |
|---|---|
| Molecular Weight | 75 kDa including tags |
| Sequence | GWTPIIWAAEHKHIEVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIA EVLLNARCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGANPELRNKEG DTAWDLTPERSDVWFALQLNRKLRLGVGNRAIRTEKIICRDVARGYENVP IPCVNGVDGEPCPEDYKYISENCETSTMNIDRNITHLQHCTCVDDCSSSN CLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQACSCWRNCKNRVVQS GIKVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELISDAEADVREDDS YLFDLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFP RIAFFSSRDIRTGEELGFDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIAL EQSRLARLDPHPELLPELGS LPPVNT |
| Sequence Similarities | Belongs to the class V-like SAM-binding methyltransferase superfamily. Histone-lysine methyltransferase family. Suvar3-9 subfamily. Contains 7 ANK repeats. Contains 1 post-SET domain. Contains 1 pre-SET domain. Contains 1 SET domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Nucleus. Chromosome. Associates with euchromatic regions. Does not associate with heterochromatin. |
| Tissue Specificity | Expressed in all tissues examined, with high levels in fetal liver, thymus, lymph node, spleen and peripheral blood leukocytes and lower level in bone marrow. |
| Domain | The SET domain mediates interaction with WIZ.The ANK repeats bind H3K9me1 and H3K9me2. |
| Function | Histone methyltransferase that specifically mono- and dimethylates 'Lys-9' of histone H3 (H3K9me1 and H3K9me2, respectively) in euchromatin. H3K9me represents a specific tag for epigenetic transcriptional repression by recruiting HP1 proteins to methylated histones. Also mediates monomethylation of 'Lys-56' of histone H3 (H3K56me1) in G1 phase, leading to promote interaction between histone H3 and PCNA and regulating DNA replication. Also weakly methylates 'Lys-27' of histone H3 (H3K27me). Also required for DNA methylation, the histone methyltransferase activity is not required for DNA methylation, suggesting that these 2 activities function independently. Probably targeted to histone H3 by different DNA-binding proteins like E2F6, MGA, MAX and/or DP1. May also methylate histone H1. In addition to the histone methyltransferase activity, also methylates non-histone proteins: mediates dimethylation of 'Lys-373' of p53/TP53. Also methylates CDYL, WIZ, ACIN1, DNMT1, HDAC1, ERCC6, KLF12 and itself. |
| Post-translational Modifications | Methylated at Lys-185; automethylated. |
Storage & Shipping
| Shipping and Storage | Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. pH: 8.00Constituents: 0.71% Tris HCl, 0.72% Sodium chloride, 0.05% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.02% Potassium chloride, 10% Glycerol (glycerin, glycerine) This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
