Recombinant Mouse IL-11 Protein (Active) (RMPP-00230088)
Cat. No.: RMPP-00230088
Category: Recombinant Protein
Research Area: Epigenetics and Nuclear Signaling
INQUIRY
10 μg
100 μg
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | ELISA; SDS-PAGE; WB |
| Key Features | Expression system: Wheat germ; Suitable for: ELISA, SDS-PAGE, WB |
Protein Information
| UniProt ID | P43694 |
|---|---|
| Molecular Weight | 37 kDa |
| Sequence | ASGASSNSSNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGH GPSIHPVLSALKLSPQGYASPVSQSPQTSSKQDSWNSLVLADSHGDIITA |
| Sequence Similarities | Contains 2 GATA-type zinc fingers. |
| Protein Length | Protein fragment |
| Cellular Localization | Nucleus. |
| Function | Transcriptional activator that binds to the consensus sequence 5'-AGATAG-3' and plays a key role in cardiac development. Involved in bone morphogenetic protein (BMP)-mediated induction of cardiac-specific gene expression (By similarity). Binds to BMP response element (BMPRE) DNA sequences within cardiac activating regions (By similarity). Acts as a transcriptional activator of ANF in cooperation with NKX2-5 (By similarity). Promotes cardiac myocyte enlargement. Required during testicular development. May play a role in sphingolipid signaling by regulating the expression of sphingosine-1-phosphate degrading enzyme, spingosine-1-phosphate lyase. |
| Involvement in Disease | Atrial septal defect 2Ventricular septal defect 1Tetralogy of FallotAtrioventricular septal defect 4Testicular anomalies with or without congenital heart diseaseGATA4 mutations can predispose to dilated cardiomyopathy (CMD), a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death. |
| Post-translational Modifications | Methylation at Lys-300 attenuates transcriptional activity. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
