Recombinant Mouse M-CSF Protein (RMPP-00230402)
Cat. No.: RMPP-00230402
Category: Recombinant Protein
Research Area: Neuroscience
INQUIRY
10 μg
1 mg
Product Features
| Source | E.coli |
|---|---|
| Purity | > 90% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | Functional Studies; SDS-PAGE |
| Key Features | Expression system: E.coli; Purity: > 90% SDS-PAGE; Active: Yes; Suitable for: Functional Studies, SDS-PAGE |
Protein Information
| UniProt ID | P48431 |
|---|---|
| Molecular Weight | 37 kDa |
| Sequence | MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMV WSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRAL HMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLG AGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRY DVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASS SPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQS GPVPGTAINGTLPLSHMESGGGGSPGRRRRRRRRRRR |
| Sequence Similarities | Contains 1 HMG box DNA-binding domain. |
| Protein Length | Full length protein |
| Cellular Localization | Nucleus. |
| Function | Transcription factor that forms a trimeric complex with OCT4 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206 (By similarity). Critical for early embryogenesis and for embryonic stem cell pluripotency. |
| Involvement in Disease | Defects in SOX2 are the cause of microphthalmia syndromic type 3 (MCOPS3). Microphthalmia is a clinically heterogeneous disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues (anophthalmia). In many cases, microphthalmia/anophthalmia occurs in association with syndromes that include non-ocular abnormalities. MCOPS3 is characterized by the rare association of malformations including uni- or bilateral anophthalmia or microphthalmia, and esophageal atresia with trachoesophageal fistula. |
| Post-translational Modifications | Sumoylation inhibits binding on DNA and negatively regulates the FGF4 transactivation. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. pH: 7.50Constituents: Potassium chloride, 0.24% Tris, EDTA, Glycerol, Sodium chlorideAlso contains DTT and Arginine. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
