Recombinant Mouse BMP4 Protein (Active) (RMPP-00230905)
Cat. No.: RMPP-00230905
Category: Recombinant Protein
Research Area: Cardiovascular
INQUIRY
10 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 80% Densitometry. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | DDDDK tag N-Terminus |
| Form | Lyophilized |
| Applications | SDS-PAGE; WB |
| Key Features | Expression system: HEK 293 cells; Purity: > 80% Densitometry; Tags: DDDDK tag N-Terminus; Suitable for: SDS-PAGE, WB |
Protein Information
| UniProt ID | P06858 |
|---|---|
| Molecular Weight | 52 kDa including tags |
| Sequence | HVDYKDDDDKPAGADQRRDFIDIESKFALRTPEDTAEDTCHLIPGVAESV ATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWL SRAQEHYPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHA AGIAGSLTNKKVNRITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTR GSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIRVIAERGLGDVDQLV KCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKGLCLSCRKNRCNNLG YEISKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESETHTNQAFEI SLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSY FSWSDWWSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVK CHDKSLNKKSG |
| Sequence Similarities | Belongs to the AB hydrolase superfamily. Lipase family. Contains 1 PLAT domain. |
| Protein Length | Full length protein |
| Cellular Localization | Cell membrane. Secreted. Locates to the plasma membrane of microvilli of hepatocytes with triacyl-glycerol-rich lipoproteins (TRL). Some of the bound LPL is then internalized and located inside non-coated endocytic vesicles. |
| Function | The primary function of this lipase is the hydrolysis of triglycerides of circulating chylomicrons and very low density lipoproteins (VLDL). Binding to heparin sulfate proteogylcans at the cell surface is vital to the function. The apolipoprotein, APOC2, acts as a coactivator of LPL activity in the presence of lipids on the luminal surface of vascular endothelium. |
| Involvement in Disease | Defects in LPL are the cause of lipoprotein lipase deficiency (LPL deficiency); also known as familial chylomicronemia or hyperlipoproteinemia type I. LPL deficiency chylomicronemia is a recessive disorder usually manifesting in childhood. On a normal diet, patients often present with abdominal pain, hepatosplenomegaly, lipemia retinalis, eruptive xanthomata, and massive hypertriglyceridemia, sometimes complicated with acute pancreatitis. |
| Post-translational Modifications | Tyrosine nitration after lipopolysaccharide (LPS) challenge down-regulates the lipase activity. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -80°C. pH: 7.50Constituents: 0.24% Tris buffer, 0.29% Sodium chloride |
|---|
For research use only. Not for clinical use.
