Recombinant Mouse IL-2 Receptor alpha Protein (Active) (RMPP-00230415)
Cat. No.: RMPP-00230415
Category: Recombinant Protein
Research Area: Cell Biology
INQUIRY
100 μg
1 mg
Product Features
| Source | E.coli |
|---|---|
| Purity | > 98% SDS-PAGE. > 98% by HPLC. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Form | Lyophilized |
| Applications | Functional Studies; SDS-PAGE; HPLC |
| Key Features | Expression system: E.coli; Purity: > 98% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Suitable for: Functional Studies, SDS-PAGE, HPLC |
Protein Information
| UniProt ID | P09486 |
|---|---|
| Molecular Weight | 33 kDa |
| Sequence | APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVV AENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNK TFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRM RDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLA RDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTT RFFETCDLDNDKYIALDEWAGCFGIKQKDI |
| Sequence Similarities | Belongs to the SPARC family. Contains 1 EF-hand domain. Contains 1 follistatin-like domain. Contains 1 Kazal-like domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted > extracellular space > extracellular matrix > basement membrane. In or around the basement membrane. |
| Developmental Stage | Expressed at high levels in tissues undergoing morphogenesis, remodeling and wound repair. |
| Function | Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Constituent: PBS0.2 µm filtered. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
